SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_045437042.1.35409 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_045437042.1.35409
Domain Number 1 Region: 9-108
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000209
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_045437042.1.35409
Sequence length 114
Comment SMI1/KNR4 family protein [Acinetobacter calcoaceticus]; AA=GCF_000818215.1; RF=na; TAX=471; STAX=471; NAME=Acinetobacter calcoaceticus; strain=P23; AL=Contig; RT=Major
Sequence
MPLLNEIRAKIERDFQRQLPDIYFELLKFSNGFLFESGVVIYSSDEVLERNQTFEVQKYA
GDYLAIGDDSGGISILIPFLGTGVFVVDQGSMDPNDMSKISDSLMNWFKAGCQI
Download sequence
Identical sequences A0A0A8XJQ1
WP_045437042.1.35409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]