SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_045497593.1.73586 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_045497593.1.73586
Domain Number 1 Region: 13-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-17
Family SMI1/KNR4-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_045497593.1.73586
Sequence length 188
Comment glucan biosynthesis protein [Streptococcus cristatus]; AA=GCF_001588855.1; RF=na; TAX=45634; STAX=45634; NAME=Streptococcus cristatus; strain=DOBICBV2; AL=Contig; RT=Major
Sequence
MLRIFPYDTEGVEQAIADFEDRFTIKFPEKYKEFLLKYNGGNSLQTSFSINRKTSDIRAF
YGFNKASQYNNFQYLIESGFLEEVLDRGFIPIAKDSFGNSILLGVTDKNFNQIAFFDHEG
QLVQSLEINFEDWVAKLKSKKKKIRTIEERIADMRAVGSKKEITPRLKEIWQEEIDKYAG
REQVIVRL
Download sequence
Identical sequences A0A0F2CYC0
WP_045497593.1.57833 WP_045497593.1.73586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]