SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_045616953.1.32092 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_045616953.1.32092
Domain Number 1 Region: 5-110
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000051
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_045616953.1.32092
Sequence length 111
Comment hypothetical protein [Streptococcus oralis]; AA=GCF_002096215.1; RF=na; TAX=1077464; STAX=1303; NAME=Streptococcus oralis subsp. tigurinus; strain=OD_348934_12; AL=Scaffold; RT=Major
Sequence
MKRDEFGFVLPNLYYQFLTEWKEIDPFEIGDTGICLYAKEDLQERNETYQIEEVEPDYFM
IGQEGDLACFIEKNADDCIYENDLGAFGSLEIQKVATNVYDFIDKILEEGL
Download sequence
Identical sequences A0A0F2E3L6
WP_045616953.1.10258 WP_045616953.1.32092 WP_045616953.1.6490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]