SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_045805620.1.68899 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_045805620.1.68899
Domain Number 1 Region: 195-239,283-386
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000209
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_045805620.1.68899
Sequence length 449
Comment hypothetical protein [Rickettsia argasii]; AA=GCF_000965185.1; RF=na; TAX=1268837; STAX=1441385; NAME=Rickettsia argasii T170-B; strain=T170-B; AL=Contig; RT=Major
Sequence
MQKILFKGPDISVRNANSDIKEIKTLAELPSGTGSEYFISAHGLEFFYKPTNLGLVGRIK
SYFMPEPSYLSMRIFSDEGTTSVLDITLLNKIQNNTTANQCNIVHIFSCHSGAAQHHLDW
IQGNMVLCTYNKASDANIVLLAQNNYDARTKNDSLFEYVSDHFHLLVASDFSISYKLDDQ
IYSFSLSANKIKQMKSIKELPAFLHKEYKAFVKFYKNIHAKYHESYPEIFNLNIETKPKE
LTYDDLIRVFSSALTLEVYNFNKFSLSKIETMLNQKGLCTDSSIANAIENGNSKLLICLL
NYGDTKVSTYNLDKAIEKGDLAILKAVLEHSTTNIESYNLDKAIEKGDLAILKAVLEHST
TNIESYNLNKAIEKGDLAILKAVLEHPTIEVGSYNIYKAEEAHNLDVIELVKKYYNSTIN
TITSEENTIYTTLTVVEEVPALGEGTEGV
Download sequence
Identical sequences A0A0F3RF62
WP_045805620.1.68899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]