SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_045970335.1.77598 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_045970335.1.77598
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.94e-29
Family SMI1/KNR4-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_045970335.1.77598
Sequence length 143
Comment 1,3-beta-glucan synthase regulator [Xenorhabdus doucetiae]; AA=GCF_000968195.1; RF=representative genome; TAX=351671; STAX=351671; NAME=Xenorhabdus doucetiae; strain=FRM16; AL=Complete Genome; RT=Major
Sequence
MNREKLLDLFVQHSDLLNMGNTDDAPSTEWIEKAESALSLTLPDDYKWFLGRFGGGDICG
DEIYSIYCIPFEEAVGGDLVYQNTIANDYLNEGRLVVSNTDFGEEFYFDTRELKAIYVAL
GEEHKLYASNFIEFLYKRLMSYI
Download sequence
Identical sequences A0A068QRU7
WP_045970335.1.77598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]