SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_046042531.1.59402 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_046042531.1.59402
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-34
Family SMI1/KNR4-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_046042531.1.59402
Sequence length 154
Comment hypothetical protein [Pseudomonas fluorescens]; AA=GCF_000967965.1; RF=na; TAX=294; STAX=294; NAME=Pseudomonas fluorescens; strain=C8; AL=Scaffold; RT=Major
Sequence
MNKPTLLELENLIKQHPDIAAFGSPADAVSDDWLVKAEKKIRHKLPASYKWFLLNYAGGE
VGTEEIYSIYGMDFEDINGGDIVFQHLNGLKHKSTTAKKVVISETDLGEVFFFDYDTYNG
EECQIFIRIPSGQNLLYANNFYEFLAKRIKAFLP
Download sequence
Identical sequences A0A0F4TG64
WP_046042531.1.59402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]