SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_046343850.1.53125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_046343850.1.53125
Domain Number 1 Region: 218-280,311-365
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000497
Family SMI1/KNR4-like 0.015
Further Details:      
 
Domain Number 2 Region: 23-61,89-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000314
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_046343850.1.53125
Sequence length 372
Comment glucan biosynthesis protein [Xanthomonas campestris]; AA=GCF_000972745.1; RF=na; TAX=339; STAX=339; NAME=Xanthomonas campestris; strain=17; AL=Complete Genome; RT=Major
Sequence
MAALKWMIYGRSPSLATFWDEALNLGRVPASEAAIAAAQARLGVRLPAWLRSLYARYDGG
AVQMARGQSLEEPDNWLKAEWLIPRARLLGSAELFSFAQVRAREDYRDDAFAGLAAGSDD
GRLIVIAADDRAPSRALCLDYSVSDVEPTVVYVDAGNNRRLAEFANVDALLSQLVDVHYW
SPALQAKHDGDVVRWQPQPPALTTFWSGAGYWNDGGAAADASVLAATEARLGVRLPALFK
QLYSVQDGGDTGWCWVPRTRFPSDLYVDWECVLVDRYLSPLAKIGSLLDLAAAFEDPDDF
SAAACLHAGLDRVLVLSSHNIDCLLCLDYRARGPQCEPDVVYFDRWEGLVPTWRAPSFDA
FFSVLRQADLDC
Download sequence
Identical sequences A0A0E3YNA4
WP_046343850.1.53125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]