SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_046499157.1.80356 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_046499157.1.80356
Domain Number 1 Region: 174-377
Classification Level Classification E-value
Superfamily Lysozyme-like 1.49e-63
Family Family 19 glycosidase 0.0000136
Further Details:      
 
Domain Number 2 Region: 36-160
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.31e-41
Family Ricin B-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_046499157.1.80356
Sequence length 377
Comment chitinase [Streptomyces sp. NRRL B-24891]; AA=GCF_000981895.1; RF=na; TAX=1417980; STAX=1417980; NAME=Streptomyces sp. NRRL B-24891; strain=NRRL B-24891; AL=Contig; RT=Major
Sequence
MPRQSFRGLSLARSAVVLAVGALFATLFAVPASAADPVGQITGLGGKCVDVAGASNANGT
PVQLYDCNGSAAQSWTVAGDGTLRALGKCLDIVDRGTADGSLVQLWDCGGGANQKWVVNS
ARDIVNPQANKCLDVKDRSTANGARLQIWTCTGQSNQKWTAAGTTPGGGNPSGFVVSESQ
FNQMFPSRNPFYTYSGLTAALSAYPGFANSGSDTVKRQEAAAFLANVSHETGGLVHVVEQ
NTANYPHYCDAGQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGINLLADPWRVERES
AVAWKTGLWYWNTQNGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPAQVQSRVTNY
QRFTQILGVAPGNNLYC
Download sequence
Identical sequences WP_046499157.1.80356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]