SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_046503570.1.67059 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_046503570.1.67059
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.09e-18
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_046503570.1.67059
Sequence length 144
Comment SMI1/KNR4 family protein [Paenibacillus riograndensis]; AA=GCF_000981585.1; RF=na; TAX=1073571; STAX=483937; NAME=Paenibacillus riograndensis SBR5; AL=Complete Genome; RT=Major
Sequence
MGVKSWLFYEELLDDTIITSVENNFGIVFPSDYKKCVEMYNGGYPNPNCFDMDNGEQGIL
NDLLSFIDSDLNIMMFYNFAEESSIDGLVPFARDPFGNLLCFDYRLNKTSPQVIFFDHEE
AGEEAVIPVCSTFTELLDGLYSIK
Download sequence
Identical sequences A0A0E4HE50
WP_046503570.1.67059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]