SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_046711914.1.90154 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_046711914.1.90154
Domain Number 1 Region: 20-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000419
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_046711914.1.90154
Sequence length 393
Comment SMI1/KNR4 family protein [Myxococcus fulvus]; AA=GCF_000988565.1; RF=na; TAX=1334629; STAX=33; NAME=Myxococcus fulvus 124B02; strain=124B02; AL=Complete Genome; RT=Major
Sequence
MSSALPPVLAARARRNSQNPHLTRERLERFEAGLPQPLPPDFRDVLVAYNGLYLDPCATG
LRDALGDEVQIDELLGLHDHDWTPLRLGGTDIPLDILVFTQQRGSVNRFGVQLVDRPDSP
RGTVWFFDCNAETETSDLYVPSACAASFGEFLARLVPLPEDPRFFTPPDDEPTPPESLEK
VPADVPTPEKPLVLAGHGHTVEDARLDIRVTTLLRDEGASAWRYQPDRATARYDLELRVD
STSDEDGQPAPYASAMPVTEANQGRHPTLAEWPGLVVGQEEPWDAWLGPDAPSMGGNRLT
VLERSGADLKVRWEARYSRAGQDLPFLFEGPARIGGIRFEVTSPEDIDRVLASAFEGRHQ
ADEWIRIVGEQRDRGARVPEEGRYVFPVKLIPR
Download sequence
Identical sequences A0A0F7E4U4
WP_046711914.1.90154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]