SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_047072196.1.16100 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_047072196.1.16100
Domain Number 1 Region: 31-168
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.54e-22
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_047072196.1.16100
Sequence length 169
Comment glucan synthesis protein [Brevibacillus formosus]; AA=GCF_001012775.1; RF=na; TAX=54913; STAX=54913; NAME=Brevibacillus formosus; strain=DSM 9885; AL=Scaffold; RT=Major
Sequence
MKNNLSELVLEGFKKRLDNSNRLLVQNRNGKVDTAHFTFNPPANAEEIEEFLRSTHWHLP
TDYKDFLLIHNGAWLFKSVRYGGGYELLSLDEIKDNHLDYMPVHWYPISINNGDYIFIDS
NRVKDGQNNYLVCFNHDDVSVSEGYYLNMNFETWLERLIIAQGTEFWTW
Download sequence
Identical sequences A0A0H0SGI5
WP_047072196.1.16100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]