SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_047202592.1.23142 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_047202592.1.23142
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.8e-21
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_047202592.1.23142
Sequence length 131
Comment SMI1/KNR4 family protein [Bacillus pumilus]; AA=GCF_001017485.1; RF=na; TAX=1408; STAX=1408; NAME=Bacillus pumilus; strain=15.1; AL=Contig; RT=Major
Sequence
MLNLTQILNLHVNKPASDIHIKEAESQLNMVLPHAYKELLKQTNGCSVGGDVLLYGTEDI
VERNATWEVQQYANGYAAIGDDGGGRVLLMRQAEEEKKVWIVDTGVMDPQHAELVAEDLL
SWVNEGCFIEV
Download sequence
Identical sequences A0A0H1RZ75
WP_047202592.1.23142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]