SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_047212439.1.88405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_047212439.1.88405
Domain Number 1 Region: 13-165
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.58e-20
Family SMI1/KNR4-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_047212439.1.88405
Sequence length 169
Comment SMI1/KNR4 family protein [Pandoraea thiooxydans]; AA=GCF_001931675.1; RF=representative genome; TAX=445709; STAX=445709; NAME=Pandoraea thiooxydans; strain=ATSB16; AL=Complete Genome; RT=Major
Sequence
MKQDWERLEAWLRLNEAKTLADLNSPATTTAIQDLERRLGCSLPSGYIECLKIHAGQQGK
AKWLFDGNEFLSLQNVILSWATWNDLLEDGDLEGSTAQSDKGIQAVWWSRGWIPFASNGG
GDFLCLDMTPASGGRSGQVIEIFHDFPARKLVAPDFNSWFSNFVGSKLG
Download sequence
Identical sequences A0A0G3EJ34
WP_047212439.1.29475 WP_047212439.1.88405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]