SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_047701458.1.76864 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_047701458.1.76864
Domain Number 1 Region: 10-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000863
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_047701458.1.76864
Sequence length 157
Comment SMI1 / KNR4 family protein [Pseudomonas mediterranea]; AA=GCF_001412185.1; RF=na; TAX=183795; STAX=183795; NAME=Pseudomonas mediterranea; strain=TEIC1105; AL=Scaffold; RT=Major
Sequence
MLENKFSDCETAITSTDLDHLETIIGKKLPVTFRNHYLKYNGGMPERAYWVSEDFYDPIE
VASFRPIAYGEPTLLSTYQLMLKKQVLPTHLLPFADDLGGNFFCLNLDSGAISYFTTDTF
DSDLSPEENQAESEKLVCSNFLRFVQGLIDEEDLDEA
Download sequence
Identical sequences A0A0A4HNW6
WP_047701458.1.23779 WP_047701458.1.42967 WP_047701458.1.44014 WP_047701458.1.68927 WP_047701458.1.76864 WP_047701458.1.95574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]