SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_048354728.1.92492 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048354728.1.92492
Domain Number 1 Region: 26-115
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000012
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_048354728.1.92492
Sequence length 120
Comment hypothetical protein [Bacillus glycinifermentans]; AA=GCF_001042465.1; RF=na; TAX=1664069; STAX=1664069; NAME=Bacillus glycinifermentans; strain=KJ-17; AL=Contig; RT=Major
Sequence
MSIQFSEENINIEGFEYPQSFLKIIELNLVDFDLWYIMSETQVLRRLEGLKERYPNRKLI
PFARRDDNDDIACFEVGKGEKVQIIHDFASEGYEQRKEYMNFWEWLEAAIQEMIEFNKGD
Download sequence
Identical sequences A0A0J6EIY5
WP_048354728.1.92492 WP_048354728.1.99318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]