SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_048560102.1.67283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048560102.1.67283
Domain Number 1 Region: 9-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.29e-20
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_048560102.1.67283
Sequence length 163
Comment SMI1 / KNR4 family protein [Bacillus cereus]; AA=GCF_001044815.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=MHI 226; AL=Contig; RT=Major
Sequence
MRKDLEWEYADVEVSETKIKEIGLQLGFQLPQDYIDCVKINGGASVLPEEFNVGNVERCF
GSLFSFDEESSEYIVKKYEIYKPTLPQKVFPIAIDPAGNLICLDYKNNTENPIVIFWEHE
NAGEKEMLMHQEGLTEAQVEELARENVFFVANTFTEFLSKLHD
Download sequence
Identical sequences A0A0J7DJV1
WP_048560102.1.67283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]