SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_048583072.1.39510 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048583072.1.39510
Domain Number 1 Region: 22-158
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.1e-17
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_048583072.1.39510
Sequence length 188
Comment SMI1/KNR4 family protein [Streptomyces viridochromogenes]; AA=GCF_001047325.1; RF=na; TAX=1938; STAX=1938; NAME=Streptomyces viridochromogenes; strain=NRRL 3414; AL=Contig; RT=Major
Sequence
MTENEQLLTRVADKARTIRPWGWTSLPEPVDAATLARAEAALGFRLPPLLADLYLRIGDG
GFGPEYGLLPLLDSSPAGEPAAVTQYLANRENAHKDPGWPWPEDVLPISHWGCAMYACVD
CRSPQATVLLFEPNADDADQAWYVDAPSLTDWLRTWVDGTGWYEETNEESEMAPWADFRI
RTAAVRAS
Download sequence
Identical sequences A0A0J7ZAA2
WP_048583072.1.39510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]