SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_049578330.1.22217 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_049578330.1.22217
Domain Number 1 Region: 173-376
Classification Level Classification E-value
Superfamily Lysozyme-like 4.78e-65
Family Family 19 glycosidase 0.0000194
Further Details:      
 
Domain Number 2 Region: 40-159
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.78e-42
Family Ricin B-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_049578330.1.22217
Sequence length 376
Comment chitinase [Streptomyces sp. SBT349]; AA=GCF_001083795.1; RF=na; TAX=1580539; STAX=1580539; NAME=Streptomyces sp. SBT349; strain=SBT349; AL=Scaffold; RT=Major
Sequence
MSIRFLRRLTLGRSAALAALSAILAGLIVAAPAQAADGQISGLGGKCVDVAGASTANGTP
VQIYDCNGSNAQRWSNSGDGTLRALGKCLDVVGGGTADGTAVQLWDCTGSPAQRWVVTAA
NDIVNPQADKCLDIRDRSTANGTRLQIWTCTGQTNQKWSAPGSGGGNPNPSGFVVSEAQF
NQMFPGRNSFYTYSGLVQALNSYPAFANTGSDTVRRQEAAAFLANVHHETGGLVHIVEQN
QANYPNYCDWGQSYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGMDLLNNPWRVEREAA
VAWATGLWYWNTQTGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPGTVQSRVSRYQ
QFTGILGVSPGGNLYC
Download sequence
Identical sequences WP_049578330.1.22217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]