SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_049664119.1.25556 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_049664119.1.25556
Domain Number 1 Region: 32-147
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000484
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_049664119.1.25556
Sequence length 185
Comment SMI1/KNR4 family protein [Lysinibacillus xylanilyticus]; AA=GCF_001183605.1; RF=na; TAX=582475; STAX=582475; NAME=Lysinibacillus xylanilyticus; strain=DSM 23493; AL=Scaffold; RT=Major
Sequence
MVPIRQIGEDNWIENLTSFLEDHDVEVISLECEKVFQKIEKYLDWIIPSQTKDYFINFGG
IESFDFMYNLKKIDEWEVLTNSIWEFVSLHFQQEETDKYIVFSESPSNDPICFKRETGEI
YLFSHDPIKGAIVYKDFNDYLLNEIIEIQKLYTEVTFDSSKEEIEYKAALLDGNDIDFDF
RYLKL
Download sequence
Identical sequences A0A0K9FA82
WP_049664119.1.25556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]