SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_049670483.1.29136 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_049670483.1.29136
Domain Number 1 Region: 37-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.14e-18
Family SMI1/KNR4-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_049670483.1.29136
Sequence length 187
Comment SMI1/KNR4 family protein [Bacillus sp. FJAT-27916]; AA=GCF_001183965.1; RF=na; TAX=1679169; STAX=1679169; NAME=Bacillus sp. FJAT-27916; strain=FJAT-27916; AL=Scaffold; RT=Major
Sequence
MKKPGDRVKQTIYSLKKRFDDGNIIQMQTEEGYLYNATCTFNPPATDAEIAHFEQETEFI
LPKDYKEFLKITNGCSLFDDVEYGGEIDLYSLEEILKRNQGYDEYEGCYDIAYIYQDNIV
IHSTCISQNEGNYLFWKGHIDQFDEARPLESNFELWVDRFVVCQGAKFWWWPIYTSANED
KLKGKGL
Download sequence
Identical sequences A0A0K9GBJ0
WP_049670483.1.29136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]