SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_049831367.1.47209 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_049831367.1.47209
Domain Number 1 Region: 7-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000249
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_049831367.1.47209
Sequence length 141
Comment hypothetical protein [Arthrobacter sp. RIT-PI-e]; AA=GCF_001187915.1; RF=na; TAX=1681197; STAX=1681197; NAME=Arthrobacter sp. RIT-PI-e; strain=RIT-PI-e; AL=Contig; RT=Major
Sequence
MTELFADKFRALVPQYFEDEWAEEDGLSEAELTEYLEDKDFELPLALYEFYRAVGATEDV
MEAFHFFWDPDELEIEDGFLLFLEDEDEEYTWGIRVDQLDVPDPIVWRRHNARGEWQSEE
GTFTEYVLDLFEWVFEEDEEN
Download sequence
Identical sequences A0A0L0B4V1
WP_049831367.1.47209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]