SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_050690169.1.54970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_050690169.1.54970
Domain Number 1 Region: 8-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000116
Family SMI1/KNR4-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_050690169.1.54970
Sequence length 156
Comment cell wall assembly protein [Bacillus flexus]; AA=GCF_001238505.1; RF=na; TAX=86664; STAX=86664; NAME=Bacillus flexus; strain=Riq5; AL=Contig; RT=Major
Sequence
MEIKKDSIIYPLPSDNLLAEKEAFWRVKLPPDYKKMIKRNNGASLEEKAFKVKSHSYAFI
RFLCILEAPENNEAGTFDINVTWTQLEDRLTDDGDLLGVTLLPIAMLFAGDFVCLDYRNS
RDDPSVCVWDHENFAELEPITYPVADIFKEFLAMLH
Download sequence
Identical sequences A0A0L1LXF7
WP_050690169.1.54970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]