SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_050753808.1.73063 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_050753808.1.73063
Domain Number 1 Region: 23-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000068
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_050753808.1.73063
Sequence length 214
Comment hypothetical protein [Pseudobacteroides cellulosolvens]; AA=GCF_001262605.1; RF=representative genome; TAX=398512; STAX=35825; NAME=Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933; strain=DSM 2933; AL=Contig; RT=Major
Sequence
MNNVEQLSIQELWDYVTVVYEKEKPGFKSYLNPRVDIEEVNGIEEKMGFELPGQLKELYH
CNNGEKENLEGSILGLRFLSVGEMFMNWCDWLYVLKDKELMKECGKDAESIPMSAVKKVY
ANRKWIPFAHDQNGNYIGIDLDPDENGTVGQVINYGSDENKKYVIAKSLREFLVLMVRIL
ENNKPTIKTRYKRIIVKLGDDQPIQMIISKINEV
Download sequence
Identical sequences A0A0L6JVF9
WP_050753808.1.39137 WP_050753808.1.73063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]