SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_050821999.1.97561 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_050821999.1.97561
Domain Number 1 Region: 12-120
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000249
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_050821999.1.97561
Sequence length 184
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_002147415.1; RF=na; TAX=132267; STAX=1428; NAME=Bacillus thuringiensis serovar kumamtoensis; strain=BGSC 4W1; AL=Contig; RT=Major
Sequence
MSIYSDFKKNSKVEESTINKYKEYLPKELIEAWRIYGYGTFMDGYLKVINPDDFSSLVSD
TYLRSKGTIPIFTTSLGDIIIFEKDENQESYIVMINYRKGKTKVLASKFSLFIRFLEEEA
FKQRALGWLPYPEAIKQYNEPEYEECFGYTPLLGLGGEEKVENLKKVKLKEHILIITEFM
GPVQ
Download sequence
Identical sequences A0A0K0SAG4 A0A0W7YB64 A0A1W2GL14 A0A243FAM1 A0A243NL00 A0A2A8ZH23
WP_050821999.1.2251 WP_050821999.1.23307 WP_050821999.1.35694 WP_050821999.1.42485 WP_050821999.1.47000 WP_050821999.1.51681 WP_050821999.1.61243 WP_050821999.1.72484 WP_050821999.1.7593 WP_050821999.1.77567 WP_050821999.1.81570 WP_050821999.1.87777 WP_050821999.1.94308 WP_050821999.1.97561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]