SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_051430155.1.61344 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_051430155.1.61344
Domain Number 1 Region: 180-383
Classification Level Classification E-value
Superfamily Lysozyme-like 3.94e-69
Family Family 19 glycosidase 0.00000891
Further Details:      
 
Domain Number 2 Region: 49-167
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.29e-39
Family Ricin B-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_051430155.1.61344
Sequence length 383
Comment chitinase [Streptomyces roseochromogenus]; AA=GCF_000497445.1; RF=na; TAX=1352936; STAX=285450; NAME=Streptomyces roseochromogenus subsp. oscitans DS 12.976; strain=DS 12.976; AL=Chromosome; RT=Major
Sequence
MHLRLAETPYRRPRLRSLGRFLAGGVAATLLTALFTATPAQAADGQVTGLAGKCVDVAGA
NSANGTAVQLYDCNGTSAQIWSSNPGDGTLRALGKCLDVVDRGTADGAAVQLWDCGGGAN
QQWVVTAAHDIVNPAANKCLDVRDNNSANGTQLQIWTCTGGANQKWNAPAGGGSGTPSGF
VVSEAQFNQMFPNRNSFYTYNGLVQALTAYPGFANTGSDTVKKQEAAAFLANVSHETGGL
VYVVEQNTANYPTYCDWSQPYGCPAGQAAYYGRGPLQLSWNFNYKAAGDALGIDLLNNPW
QVENDPAVSWKTGLWYWNTQSGPGTMTPHNAIVNGAGFGQTIRSINGSLECDGKNPAQVQ
SRVDAYQRFTQILGVSPGSNLYC
Download sequence
Identical sequences WP_051430155.1.61344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]