SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_051519532.1.72260 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_051519532.1.72260
Domain Number - Region: 58-122
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0353
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_051519532.1.72260
Sequence length 307
Comment segregation/condensation protein A [Comamonas aquatica]; AA=GCF_000590985.1; RF=na; TAX=1457173; STAX=225991; NAME=Comamonas aquatica DA1877; strain=DA1877; AL=Contig; RT=Major
Sequence
MSDSAPDTAPAELPATAASANADLMPDVVDQVALARLYGEPLFKLPNDLYIPPDALEVFL
EAFEGPLDLLLYLIRKQNFNILDIPMLAVTQQYLRYVDEIRNRNLELAAEYLLMAAMLIE
IKSRMLLPPKKKEGEEEAEDPRAELVRRLLEYEKMKLAAQQISTLPQYGRDFLKAQVHIE
QSLQPRFPDVAVGELQAAWRDILKRAKLVQHHRITREELSVREYMSQILKQLQGQRFVEF
ERIFDPSKGSTVLVVTFIALLELGKETLIEITQAEAYAPIYVRLAYRPAATTASAPLELE
EELYERD
Download sequence
Identical sequences A0A014Q9I8
WP_051519532.1.72260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]