SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_051858485.1.88502 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_051858485.1.88502
Domain Number 1 Region: 40-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000157
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_051858485.1.88502
Sequence length 176
Comment SMI1/KNR4 family protein [Streptomyces toyocaensis]; AA=GCF_000725125.1; RF=na; TAX=55952; STAX=55952; NAME=Streptomyces toyocaensis; strain=NRRL 15009; AL=Contig; RT=Major
Sequence
MSAEEWRIHLAEFADWYLGTVSAAHRSPASDRPRGFRLRREPATARQLDAAEERLGVPLP
PSLRGFLTASNGFGPVSQYTEALRSCEEIDWFRSTHPGCVNTVGGTGDRDVLLHALCLTR
GEDVILLDTRTASADGEYGAYLFAVKYGELDERYAGFGEVVLAGHAEIEWHRTHCV
Download sequence
Identical sequences A0A081XMU3
WP_051858485.1.88502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]