SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_052374370.1.12874 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052374370.1.12874
Domain Number 1 Region: 30-98,139-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000102
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_052374370.1.12874
Sequence length 262
Comment SMI1/KNR4 family protein [Chondromyces apiculatus]; AA=GCF_000601485.1; RF=representative genome; TAX=1192034; STAX=51; NAME=Chondromyces apiculatus DSM 436; strain=DSM 436; AL=Contig; RT=Major
Sequence
MEWLDAIRSIRALKLALARRDPRRGLPVAPPGGASEEAIASAERRMGMRLPPSYRALLAM
HDGWPQIFGATGLLGVLPLTRGAYLGVAQMMIEENEGAARPESAQGAGGVASPREMAVEG
GRGQGEGDGARSRGRMRAAGLVPFGIDAEAETLFAWDPESVRADGEMEVVVWMSGLGMRL
GSFPELLELLVDMLAAELEVNVDEGDAAALSVTPVPPSSHVRQVGGAASGLARSPSRVGQ
GAPPPLSLRPAPRPAARTAFLG
Download sequence
Identical sequences A0A017TDL0
WP_052374370.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]