SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_052480561.1.36240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052480561.1.36240
Domain Number 1 Region: 23-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000183
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052480561.1.36240
Sequence length 162
Comment SMI1/KNR4 family protein [Chryseobacterium sp. StRB126]; AA=GCF_000829375.1; RF=na; TAX=878220; STAX=878220; NAME=Chryseobacterium sp. StRB126; strain=StRB126; AL=Complete Genome; RT=Major
Sequence
MISFKILPIEEIELEVLKEKGNLQNFPKTVDFPFPERYKKLVSLIKTTEIASEAILYNVV
EAVNENKEFVLPDYWCFAGNGQGDRWFLDKNGHVFFYDHDYDEKLEPMNISLEQWLQMAF
VIQQLDLYFDEHDDISAPVRQKFYEALDAIHPGLSEVYPFTV
Download sequence
Identical sequences A0A077KIV5
WP_052480561.1.36240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]