SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_052843179.1.85116 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052843179.1.85116
Domain Number 1 Region: 160-363
Classification Level Classification E-value
Superfamily Lysozyme-like 6.47e-66
Family Family 19 glycosidase 0.00000964
Further Details:      
 
Domain Number 2 Region: 12-131
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.4e-38
Family Ricin B-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052843179.1.85116
Sequence length 363
Comment chitinase [Kitasatospora aureofaciens]; AA=GCF_000720845.1; RF=na; TAX=1894; STAX=1894; NAME=Kitasatospora aureofaciens; strain=NRRL B-2183; AL=Contig; RT=Major
Sequence
MTLAGDSASGQITGLAGKCIDVADGNGANGTQVQLYDCNGTSAQQWTEPGDGTLRALDKC
LDVRDGSTADAADVQLWDCNGSPAQQWVITQAKDIVNPAANKCLDVRAYNSANRTPLQLW
PCQGAANEKWEVAGGDTDTVVGERPAPLPERHSDAPASEFVVSEAQFDQMFPNRNPVYTY
GGLRAALSAYPAFANSGSDTVKKQEAAAFLANVSHETGGLAHIVEQNTANYSSYCDADQP
YGCPSGQSAYYGRGPIQLSWNYNYKAAGDALGIDLLHNPDLVASDSSVAWKTGLWYWNTQ
TGPGSTTPHDAIVNGAGFGQTIRSINGALECDGKYPAEVQSRVDSYTGFTRILGVDPGSD
LSC
Download sequence
Identical sequences WP_052843179.1.85116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]