SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_053176070.1.12662 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_053176070.1.12662
Domain Number 1 Region: 36-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000549
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_053176070.1.12662
Sequence length 202
Comment SMI1/KNR4 family protein [Streptomyces virginiae]; AA=GCF_001270565.1; RF=na; TAX=1961; STAX=1961; NAME=Streptomyces virginiae; strain=NRRL B-1447; AL=Contig; RT=Major
Sequence
MTPAPDPAHELATKRQVTEVWQRISSWLAQHAPASQAALLPGLTDDAIDLFECDLGVRIP
VELRALWHMCGGDSGTNRGGCMPGNTALMPREQIVDFYRQQINSQSSGWGVDWIPVISNR
VGDCAIGLYLDTGTGLLGQWSRYGDIELDEADTVATYLEEVADMLEYPALAARDLPGLVG
GRLVWGDSLDPADDEAWRPLAG
Download sequence
Identical sequences A0A0L8M5R4
WP_053176070.1.12662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]