SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_053332513.1.96149 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_053332513.1.96149
Domain Number 1 Region: 9-45,73-166
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.55e-20
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_053332513.1.96149
Sequence length 265
Comment SMI1/KNR4 family protein [Candidatus Jidaibacter acanthamoeba]; AA=GCF_000815465.1; RF=na; TAX=86105; STAX=86105; NAME=Candidatus Jidaibacter acanthamoeba; strain=UWC36; AL=Contig; RT=Major
Sequence
MKHMEVRECENPITIDEVLEAEETIGAKLPSDYVEHILKYNGGHPDKDCYPLLEPLPYYN
RITKTEDKSFDSGISWFYAIYEGEYESFLRGCRFNGDRLPKGLIAIGRDSFGNLICISVG
LGNYGKVYFWEYKGSVPLGEEPWWDNVFLIANSFTDFINSLYSRSIGRNEDTKFIDVHDK
YSLPYYLNNGRKHAELMKSFFAKAPIEVEEFIVEEIEENSDLILKYEVPSEKKRYVRYIT
DKTGEYKDAIEDVDSYSLQGKPAAR
Download sequence
Identical sequences A0A0C1QNZ1
WP_053332513.1.96149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]