SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_053709706.1.99541 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_053709706.1.99541
Domain Number 1 Region: 164-367
Classification Level Classification E-value
Superfamily Lysozyme-like 5.34e-68
Family Family 19 glycosidase 0.00000838
Further Details:      
 
Domain Number 2 Region: 31-150
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.83e-40
Family Ricin B-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_053709706.1.99541
Sequence length 367
Comment chitinase [Streptomyces sp. NRRL B-3648]; AA=GCF_001279545.1; RF=na; TAX=1519493; STAX=1519493; NAME=Streptomyces sp. NRRL B-3648; strain=NRRL B-3648; AL=Contig; RT=Major
Sequence
MHPGRLLAAVISASLAVLFAVTPAQAADGQISGLAGKCVDVAGANSANGTAVQLYDCNGT
AAQRWSNPGDGTLRALGKCLDVVDRATADGAAVQLWDCSGGANQQWVVSAARDIVNPAAN
KCLDVRDNNSANGTRLQIWSCSGGANQKWNAPASGGGDTTPSGFVVSEAQFNQMFPNRNS
FYTYSGLTAALRAYPGFANTGSDTVKKQEAAAFLANVSHETGGLVYVVEQNTANYPHYCD
WSQSYGCPAGQAAYYGRGPLQLSWNFNYKAAGDALGIDLLGNPWLVQNDSAVAWKTGLWY
WNTQSGPGTMTPHNAMVGGAGFGQTIRSINGSLECDGKNPAQVQSRVDAYQRFTQILGVS
PGANLYC
Download sequence
Identical sequences A0A0M8X2K5
WP_053709706.1.99541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]