SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_053756297.1.14387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_053756297.1.14387
Domain Number 1 Region: 151-354
Classification Level Classification E-value
Superfamily Lysozyme-like 7.87e-67
Family Family 19 glycosidase 0.0000105
Further Details:      
 
Domain Number 2 Region: 17-139
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.05e-42
Family Ricin B-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_053756297.1.14387
Sequence length 354
Comment chitinase [Streptomyces sp. AS58]; AA=GCF_001279985.1; RF=na; TAX=1519489; STAX=1519489; NAME=Streptomyces sp. AS58; strain=AS58; AL=Contig; RT=Major
Sequence
MTLSTGLLTASPAQAATGAITGLAGKCLDVAAANSADGTPVQLYDCNGTGAQQWNVGSDG
TIRALGKCLDVTGNSTADGAKLQLWTCTGGANQRWTVTAARDIVNPQADKCLDVTDNNSA
NGTRVQIWTCSGGANQKWTAPASGPGNPSGFVVTEAQFNQMFPGRNSFYTYSGLTAALSA
YPGFANSGSDTVKKQEAAAFLANVSHETGGLVHIVEQNQANYPHYCDWGQPYGCPAGQAA
YYGRGPIQLSWNFNYKAAGDALGIDLLNNPWLVQNDASVAWKTGLWYWNTQSGPGTMTPH
NAMVNQAGFGQTIRSINGSLECDGRNPAQVQSRVSNYQRFTQILGVTPGANLYC
Download sequence
Identical sequences A0A0M9ZUL3
WP_053756297.1.14387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]