SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_054241221.1.46933 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_054241221.1.46933
Domain Number 1 Region: 167-371
Classification Level Classification E-value
Superfamily Lysozyme-like 1.24e-65
Family Family 19 glycosidase 0.00000858
Further Details:      
 
Domain Number 2 Region: 37-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.36e-40
Family Ricin B-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_054241221.1.46933
Sequence length 371
Comment chitinase [Actinobacteria bacterium OV320]; AA=GCF_001298545.1; RF=na; TAX=1592329; STAX=1592329; NAME=Actinobacteria bacterium OV320; strain=OV320; AL=Contig; RT=Major
Sequence
MHGPRFLGRFAVFAALCAVLTTLFTVTPARAADGSITGLAGKCVDVAGAGSANGTAVQLY
DCNGTGAQIWSNPGDGTLRALGKCLDVVDRSTADGAAVQLWDCSGGTNQQWVVSGAKDIV
NPAANKCLDVTGNNGANGTRLQIWTCSGGANQKWNAPANGGGGTPSGFVVTEAQFNQMFP
SRNAFYTYSGLTAALSAYPGFANTGSDTVKKQEAAAFLANVNHETGGLVHIVEQNTANYP
TYCDWGQWYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGLDLLNNPWLVQNDASVAWKT
GLWYWNTQTGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPAQVQSRVDAYNRFASI
LGVSPGSNLYC
Download sequence
Identical sequences A0A0N0NBB1
WP_054241221.1.46933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]