SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_054297330.1.556 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_054297330.1.556
Domain Number 1 Region: 166-369
Classification Level Classification E-value
Superfamily Lysozyme-like 2.19e-65
Family Family 19 glycosidase 0.0000129
Further Details:      
 
Domain Number 2 Region: 32-151
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.16e-36
Family Ricin B-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_054297330.1.556
Sequence length 369
Comment chitinase [Kibdelosporangium phytohabitans]; AA=GCF_001302585.1; RF=representative genome; TAX=860235; STAX=860235; NAME=Kibdelosporangium phytohabitans; strain=KLBMP1111; AL=Complete Genome; RT=Major
Sequence
MFRRRIAMTVSAAVALAVIVLPSGTANAATGAVTGLAGKCVDVAGASNANGTAVQLYDCN
GTGAQQWNNTGSQLQALGKCLDVSGGGTANGTVVQIWDCNGSGAQNWVVSAANDIVNTQA
NKCLDVAGNNSANGTRLQIWECTGAANQKWNAPASGGGGGGGGDGFVVSEAQFNQMFPGR
NGFYTYSGLVAALSSYPGFAKTGTDVTRKQEAAAFLANVHHETSGLVHIVEQNQANYPHY
CDWGQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGLPLLTNPWLVQNDAAVAWRTGL
WYWNTQRGPGTMTPHDAMVNGRGFGETIRSINGSIECDGGNPAQVQSRVNSYNRFVGVLG
VPAGGNLYC
Download sequence
Identical sequences A0A0N9IAI7
WP_054297330.1.556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]