SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_055194191.1.14300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_055194191.1.14300
Domain Number 1 Region: 285-389
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000275
Family Collagen-binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 813-992
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000501
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 3 Region: 558-669
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000235
Family Collagen-binding domain 0.003
Further Details:      
 
Domain Number 4 Region: 680-800
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000824
Family Collagen-binding domain 0.0059
Further Details:      
 
Domain Number 5 Region: 420-531
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000196
Family Collagen-binding domain 0.0071
Further Details:      
 
Domain Number 6 Region: 160-277
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000379
Family Collagen-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_055194191.1.14300
Sequence length 994
Comment hypothetical protein [Roseburia intestinalis]; AA=GCF_001406435.1; RF=na; TAX=166486; STAX=166486; NAME=Roseburia intestinalis; strain=2789STDY5834960; AL=Contig; RT=Major
Sequence
MKKRHQAGKKIAAWLMALSLCMTAVPAEQVVYAAGGQNETEVTELTENPETAENTEALDD
SETAESEDTEDNGEENTSEAVETDSTENESETTENTESVKDTEATESTEVTEISETTEST
QEVENSEMTETENTESVIGDTKSEDTETEESEEVVRKDGNVTPGSTYATAASIGLNTTYK
ATTSRKSVTHWYKFTMSKAGMVQLKFAHANLSSTSNSPAWKIDFIADQFGGMVSVNSGLQ
DTQNQTAKIGLEAGTYYVQVTGLGVLTIGSSDYSFSVQYEDIYCETEQNDSISTADNYTK
LGQTITGSISSTSDTDYYKITSAAKGYLSFQLQHDKVSSKLATNIYSVAVCDASGNTIYT
MTSRTDEEKTESVNFGLAAGTYYLKVSGMKYLNASGSFAIYGTNGETYKLNASWTNADNW
ESESNDTYDTANTAVSGITYSGDIRTYSDVDYFKTTLSANGYINVKLTHPVVSGQETTNM
FVFSVIRKVDKDQYTEVYTTNIRGGDTSVSTPNLGLPKGEYYVKIAGTGNSAGTLLSGTS
YPVNYDVCIKAKTAGDREVESNDSAATANSVKNGKTYYGSISSSSDKDYYKIKMSKAGYL
QLKFGHKNNQSTASCYNVVLYNKDNSEIYKFTSTGTETSFTSCKLGLAAGEYYVCVSQAS
TLYTGDYTICMTQKAASGWETENNGDWATADNIKVGKAVNGVITGYTSDKDCYRFTLTKA
QYINFSLAHEKINDSGRSWYVTLYNANGKRFYQNYDHIYCYAGSTYTESPAVKLSKGTYY
LKVQAYAKNAVEKEYTLCVNKIENRKTSVTSVKSTAYNKLKVSWKVVPAATSYQIYRSTA
KDGDYQNIKTIDDVGTSSWTDSSVKTGKTYYYKIKTVVKTQNGEQTSGFSNVKSAKAVPA
KTTLKAKASDAKNVKLTWSKVKGASGYEIYCSNSKDGKYSKVKTISKGGTTSYKNGKLKK
STTYYYKIRAYRKVNGKKVYGSYSSVVSVKTKAK
Download sequence
Identical sequences A0A173TU93
WP_055194191.1.14300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]