SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_055341779.1.8285 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_055341779.1.8285
Domain Number 1 Region: 23-82,148-211
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000392
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_055341779.1.8285
Sequence length 281
Comment hypothetical protein [Paeniclostridium sordellii]; AA=GCF_001372415.1; RF=na; TAX=1505; STAX=1505; NAME=Paeniclostridium sordellii; strain=R28058; AL=Contig; RT=Major
Sequence
MTRLNIIKNKLEKLKNFDKNYCVFGSINHKYKLNNTLSKSELKQFGKINNITLPEEYANF
LLEIGNGGAGPGYGIIGITPKQLTKRYYRFSYTFRFSGDFVPNTYNHCTMIEDDDLSCED
CDKRFSCVDAFYEDDFECEDDYISGYLDGTLNINNMGCGLESRLILNGPEFGNVWINDPD
QLFTPRRTLTKDRLSFYDWYENWLDSQLSKFELIKSLFDKKVPYEEFFNTSISDFEVEEI
IATFLGLLLIKINPSNYESSKFSLRELNVDLEKEYIRYIKQ
Download sequence
Identical sequences A0A0C7G5X1
WP_055341779.1.8285 WP_055341779.1.90398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]