SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_055611227.1.69571 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_055611227.1.69571
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 2.19e-66
Family Family 19 glycosidase 0.0000107
Further Details:      
 
Domain Number 2 Region: 37-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.24e-41
Family Ricin B-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_055611227.1.69571
Sequence length 371
Comment chitinase [Streptomyces phaeochromogenes]; AA=GCF_001418655.1; RF=representative genome; TAX=1923; STAX=1923; NAME=Streptomyces phaeochromogenes; strain=NRRL B-1248; AL=Scaffold; RT=Major
Sequence
MRRPRFLGRFAVLTSLSAVLTTLLTVTPAQAASGSITGLAGKCVDVAGASSANGTAVQLY
DCNGTGAQIWSNPGDGTLRALGKCLDIVDRSTADGAAVQLWDCAGSSNQQWVVSGANDIV
NPAANKCLDVTGNNSANGTRLQIWTCSGGANQKWSAPASGGGGTPSGFVVTEGQFNQMFP
GRNSFYTYSGLTAALSAYPGFANTGSDTVKKQEAAAFLANVNHETGGLVHIVEQNTANYP
HYCDWGQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLNNPWLVQNDAAVAWKT
GLWYWNTQNGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGKNPAQVQSRVDAYNRFTSI
LGVPPGSNLYC
Download sequence
Identical sequences WP_055611227.1.69571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]