SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_055619535.1.33184 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_055619535.1.33184
Domain Number 1 Region: 165-368
Classification Level Classification E-value
Superfamily Lysozyme-like 1.46e-65
Family Family 19 glycosidase 0.000011
Further Details:      
 
Domain Number 2 Region: 33-152
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.52e-42
Family Ricin B-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_055619535.1.33184
Sequence length 368
Comment chitinase [Streptomyces sp. JHA19]; AA=GCF_001417695.1; RF=na; TAX=1577588; STAX=1577588; NAME=Streptomyces sp. JHA19; strain=JHA19; AL=Contig; RT=Major
Sequence
MHRPRLAVLTVLAAVLAALLTAAPEARAATGSITGLAGKCVDVAGASSANGTPVQLYDCN
GTNAQIWSNSGDGTLRALGKCLDVSNRSTADGAAVHLWDCTGGANQQWVVSGARDIVNPA
ADKCLDVRGNNSANGTPLQIWTCTGAANQKWNAPASGGGGNPSGFVVSEAQFNQMFPGRN
SFYTYSGLVAALSAYPGFANSGSDTVKKQEAAAFLANVNHETGGLVHIVEQNTANYPHYC
DWGQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLNNPWRVQNEAAVAWKTGLW
YWNTQTGPGSMTPHNAMVNQAGFGQTIRSINGSLECDGKNPAQVQSRVDAYQRFTQILGV
TPGGNLYC
Download sequence
Identical sequences WP_055619535.1.33184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]