SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_057679774.1.83628 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_057679774.1.83628
Domain Number 1 Region: 218-279,311-366
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000876
Family SMI1/KNR4-like 0.019
Further Details:      
 
Domain Number 2 Region: 25-74,104-176
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000209
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_057679774.1.83628
Sequence length 372
Comment glucan biosynthesis protein [Xanthomonas axonopodis]; AA=GCF_001564415.1; RF=na; TAX=1437877; STAX=1985254; NAME=Xanthomonas phaseoli pv. dieffenbachiae LMG 695; strain=LMG 695; AL=Chromosome; RT=Major
Sequence
MAALKWMVYGRSPSLDTFWDEPLNLGRMPATEAAIAAAQARLGVRLPGWLLELYARYDGG
AVQMARGQSLEEPDNWLKAEWLIPRARLLGCADLFSFAEVRAGQDYRDDAYDGLAEGGDD
RRLIAIAADDRSPSRALCLDYSASDAEPALVYVDAGNKRRLAVFANVDDLLAQLVDVVYW
SPALQARHDGDAVHWQPQPPAVTTFWSGPGHWNAQAAAADDEAFAAAEARLGVRLPALLK
RLYAVQDGGDTCWCWVPRTRFPSDRYVDWECVLVDRDLPPLAHIRSVLDFADAFEDRTDF
SAAACLHAGLDRVLVLACHNVDSLLCLDYRARGPQHEPEVVYFETWDGLVPTWRAASFDA
FFGVLRQAELEL
Download sequence
Identical sequences A0A1V9GVL5
WP_057679774.1.55132 WP_057679774.1.72092 WP_057679774.1.83628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]