SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_059435673.1.99656 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_059435673.1.99656
Domain Number 1 Region: 57-188
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000144
Family SMI1/KNR4-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_059435673.1.99656
Sequence length 192
Comment SMI1/KNR4 family protein [Anaeromyxobacter sp. PSR-1]; AA=GCF_000964525.1; RF=na; TAX=1300915; STAX=1300915; NAME=Anaeromyxobacter sp. PSR-1; strain=PSR-1; AL=Contig; RT=Major
Sequence
MSKTQRKVDLAIDEFVARVNGSPRAALDPEVVPVNLREGRQQAAALDWVAWGIVRAPSPC
AWVDEFEAKLPGRLPRSYGSFVTRYLFPAFDVGPVTLFANTGGGVGERWELVQAAFWDEH
LSTPLLAAGFVQFGRPSGGSYDPVCFDLNKTTNAGECPVVQLDHEAALMGGKVQVVADIA
PSFMALLAREPR
Download sequence
Identical sequences A0A0D6QCM5
WP_059435673.1.99656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]