SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_062240178.1.36419 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_062240178.1.36419
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 6.19e-67
Family Family 19 glycosidase 0.00000934
Further Details:      
 
Domain Number 2 Region: 36-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.27e-40
Family Ricin B-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_062240178.1.36419
Sequence length 371
Comment chitinase [Streptomyces griseorubiginosus]; AA=GCF_001514195.1; RF=na; TAX=67304; STAX=67304; NAME=Streptomyces griseorubiginosus; strain=DSM 40469; AL=Scaffold; RT=Major
Sequence
MSFSPRAGRLAVLAALACVLTPLCTVTPAHAASGTITGLAGKCVDVAGASAANGTAVQLY
DCNGTGAQVWSNPGDGTLRALGKCLDVVDRGTADGAAVQLWDCSGGANQQWVVSGARDIV
NPAANKCLDVRDNNSANGTRLQIWTCSGTANQKWNAPASGGGSQPSGFVVSEAQFNQMFP
GRNSFYTYSGLVAALSAYPGFANTGSDTVRKQEAAAFLANVSHETGGLVHIVEQNTANYL
HYCDAGQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLGNPWLVQNDSAVAWKT
GLWYWNTQSGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPAQVQSRVDAYNRFTSI
LGVAPGGNLYC
Download sequence
Identical sequences A0A101S1J0
WP_062240178.1.36419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]