SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_062643005.1.64164 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_062643005.1.64164
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 7.31e-67
Family Family 19 glycosidase 0.00000905
Further Details:      
 
Domain Number 2 Region: 36-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.1e-40
Family Ricin B-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_062643005.1.64164
Sequence length 371
Comment chitinase [Streptomyces sp. NBRC 110468]; AA=GCF_001184025.1; RF=na; TAX=1679753; STAX=1679753; NAME=Streptomyces sp. NBRC 110468; strain=NBRC 110468; AL=Scaffold; RT=Major
Sequence
MHGPRFLGRFAVFTALCAVLTALFTAAPARAADGSISGLAGKCVDVAGAASANGTAVQLY
DCNGTGAQIWSNPGDGTLRALGKCLDVVDRGTADGSAVQLWDCSGGTNQQWVVSGARDIV
NPAANKCLDVTGNNSANGTRLQIWTCSGGANQKWNAPASGGGGTPSGFVVTEAQFNQMFP
GRNGFYTYSGLTAALSAYPGFATTGSDTVKKQEAAAFLANVHHETGGLVHIVEQNTANYP
HYCDWGQSYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLNNPWLVQNDAAVAWKT
GLWYWNTQSGPGTMTPHNAMVGQAGFGQTIRSINGSLECDGRNPAQVQSRVDAYNRFSSI
LGVSPGGNLYC
Download sequence
Identical sequences WP_062643005.1.64164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]