SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_063768092.1.97 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_063768092.1.97
Domain Number 1 Region: 31-150
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.44e-41
Family Ricin B-like 0.00031
Further Details:      
 
Domain Number 2 Region: 163-276
Classification Level Classification E-value
Superfamily Lysozyme-like 2.19e-23
Family Family 19 glycosidase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_063768092.1.97
Sequence length 276
Comment hypothetical protein [Streptomyces sp. NRRL S-1896]; AA=GCF_000725655.1; RF=na; TAX=1463893; STAX=1463893; NAME=Streptomyces sp. NRRL S-1896; strain=NRRL S-1896; AL=Scaffold; RT=Major
Sequence
MHVGRTLAGFVAACLAVLFAVTPAQAADGQITGLAGKCVDVAGANSANGTAVQLYDCNGT
NAQRWSNPGDGTLRALGKCLDVVDRSTADGAAVQLWDCSGGANQQWVVTAAHDIVNPAAN
KCLDVRDNNSANGTRLQIWSCTGGANQKWNAPASGGGTTPSGFVVSEAQFNQMFPNRNSF
YTYSGLTAALGAYPAFANTGSDTVKKQEAAAFLANPGTMTPHDAMVNGAGFGQTIRSING
SLECDGKNPAQVQSRVDAYLRFTQILGVSPGGNLYC
Download sequence
Identical sequences WP_063768092.1.97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]