SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_065405629.1.17186 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_065405629.1.17186
Domain Number 1 Region: 4-407
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.23e-80
Family Histidine acid phosphatase 0.00000000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_065405629.1.17186
Sequence length 410
Comment phytase AppA, partial [Shigella sonnei]; AA=GCF_001252215.1; RF=na; TAX=624; STAX=624; NAME=Shigella sonnei; strain=64101ss_1; AL=Scaffold; RT=Major
Sequence
qsepelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylgh
yqrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqadtss
pdplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclk
rekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritds
hqwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfi
aghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqm
rdktplslntppgevkltlagceernaqgmcslagftqivnearipacsl
Download sequence
Identical sequences WP_065405629.1.17186 1dklA 1dkl_A 1dkl_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]