SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_065589906.1.84936 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_065589906.1.84936
Domain Number 1 Region: 143-288
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.01e-17
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 2 Region: 42-112
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000051
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_065589906.1.84936
Sequence length 299
Comment SMI1/KNR4 family protein [Gilliamella apicola]; AA=GCF_001690575.1; RF=na; TAX=1196095; STAX=1196095; NAME=Gilliamella apicola; strain=Bim3-2; AL=Contig; RT=Major
Sequence
MVYKDIWKTTVPPYKLQVFNFIPIKYNKAFKNDPDFIMEGIAFKHWDDKKLPKELLPFAR
DLSNGFLCININTGAIYQYLRLEWDDTLNTEQNFKKNSIYLSDSLENFLNALTYDEEQSN
AETVEDEDIKPRASNKFYDSEQAINTADLSEVEKLLKIKIPVQLRQFLLHHNGGMPENNA
WLDPEGEFEWVAIHELIPVKYYKKFNNNKNYLMPFKAADLWGRKLLPETFLPFAIDAGGN
YFCIDINNGKIYYYTLDTWSGNLSLTDNQDKSTLFLCNSFNEFISKLVCEDDLDDLYGL
Download sequence
Identical sequences A0A1B9LPV0
WP_065589906.1.4241 WP_065589906.1.84936 WP_065589906.1.86714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]