SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_067699644.1.90519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_067699644.1.90519
Domain Number 1 Region: 177-406
Classification Level Classification E-value
Superfamily Lysozyme-like 1.15e-84
Family Chitosanase 0.0000000712
Further Details:      
 
Domain Number 2 Region: 38-156
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.76e-38
Family Ricin B-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_067699644.1.90519
Sequence length 407
Comment glycoside hydrolase [Actinoplanes awajinensis]; AA=GCF_001509495.1; RF=representative genome; TAX=135947; STAX=135946; NAME=Actinoplanes awajinensis subsp. mycoplanecinus; strain=NRRL B-16712; AL=Contig; RT=Major
Sequence
MTRVRKVLYATLGLVIPGAAVIYGLLPASAATAGPIKGLGGKCIDVAGASSTNGAAIQLY
DCNNSAAQQWSVGNTDQTIRSLGKCLDVTAAATANGAKIQLYDCNATGAQKWTFTNGTLV
NAGSGKCLDVTDKSTANGARLQIWTCSTTANQTWVLPGGTSPTSPTPTSTTAAPTGKNLD
DPAKKDVAMQIVSAAENSSLNWRAQFSYIEDIKDGRGYTAGIIGFCSGTGDMLELVEAYT
ATKPSNVLAKYLPALRNVNGTESHAGLDPNFTRDWKTAAADSVFQAAQESERDRVYFNPS
VRDGKSDGVRALGQFAYYDASVVHGYEGMRSIRTRALKKAKPPAQGGDERAWLNAFMDER
VVEMKKEEAHSDVSRIDTAQRVFLNNGNFDLNTPLDFKVYGDSFHIG
Download sequence
Identical sequences A0A101JK00
WP_067699644.1.90519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]