SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_069535666.1.44406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_069535666.1.44406
Domain Number 1 Region: 157-196
Classification Level Classification E-value
Superfamily Fibritin 0.0000902
Family Fibritin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_069535666.1.44406
Sequence length 220
Comment hypothetical protein [Vibrio parahaemolyticus]; AA=GCF_001727365.1; RF=na; TAX=670; STAX=670; NAME=Vibrio parahaemolyticus; strain=CDC_K4556R; AL=Contig; RT=Major
Sequence
MAREIPLGATRYAGNSDVVSPCAFEGDLVAGVAVSSVAVSGEQPKVALFNGSAFAGFAVH
DLCNIRKVTGVVEQGKGIPVRVKDGVTLAAGNGFAVDNATGEVVPIGTADSTAIMGKIDE
LDINGLDENCEIVEGCVLVTLYGGSAPAGSDGAAGVTSVNGKTGDVTLVPADIGGVEEAP
ADGTPYERQDAGWVAASAPADAPTPESADSKTVSRSTAKK
Download sequence
Identical sequences WP_069535666.1.24073 WP_069535666.1.44406 WP_069535666.1.55855 WP_069535666.1.70743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]