SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_073005460.1.47181 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_073005460.1.47181
Domain Number 1 Region: 60-144
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000824
Family Carboxypeptidase regulatory domain 0.016
Further Details:      
 
Domain Number 2 Region: 151-209
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0000000122
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_073005460.1.47181
Sequence length 216
Comment hypothetical protein [Clostridium amylolyticum]; AA=GCF_900142075.1; RF=representative genome; TAX=1121298; STAX=1121298; NAME=Clostridium amylolyticum; strain=DSM 21864; AL=Scaffold; RT=Major
Sequence
MPSFDEYVLEINNLKQKAPKQEALPDKAVSPSTMVEATSEETLKIDIKTPINKSEPSNFI
YGFITEENGKAIEDALVELKSLKDDSKFIASTLTNLQGEYLFSSLDSGIYSISVSKEGYI
TKNTSNIALQNHQYLGQSLVLSVDPMVNMSSVQGIITDDITGKLLEDIIVGLYSRVNDIE
VLIKSTVTNNEGRYAFYMLPPGEYKIKASSFRKEDA
Download sequence
Identical sequences A0A1M6ESS8
WP_073005460.1.47181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]